PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018831-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 311aa    MW: 35834.2 Da    PI: 8.8067
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018831-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.2e-194895148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++q+G g+W++ ++  g+ R++k+c++rw +yl
    NNU_018831-RA 48 KGPWTPEEDQILINYIRQYGHGNWRALPKQAGLLRCGKSCRLRWTNYL 95
                     79******************************99************97 PP

2Myb_DNA-binding54.82.2e-17101146148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
    NNU_018831-RA 101 RGNFTKEEEETIIKLHEMLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 146
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-273998IPR009057Homeodomain-like
PROSITE profilePS5129417.6064395IPR017930Myb domain
SuperFamilySSF466899.16E-3244142IPR009057Homeodomain-like
SMARTSM007171.1E-154797IPR001005SANT/Myb domain
PfamPF002495.6E-174895IPR001005SANT/Myb domain
CDDcd001677.21E-125095No hitNo description
PROSITE profilePS5129426.496150IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-2799150IPR009057Homeodomain-like
SMARTSM007171.2E-15100148IPR001005SANT/Myb domain
PfamPF002494.5E-16101146IPR001005SANT/Myb domain
CDDcd001676.35E-11103146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
RERDRERKRD RDRKIKNSDQ IKKSEKGVWS LRSKMVRAPC CEKMGMKKGP WTPEEDQILI  60
NYIRQYGHGN WRALPKQAGL LRCGKSCRLR WTNYLRPDIK RGNFTKEEEE TIIKLHEMLG  120
NRWSAIAAKL PGRTDNEIKN VWHTHLKKRL RQYQTTTNTK RPSTGVPKRD TNTPKESHSV  180
NFPIIPAFEN PVYPPVSSPQ QSSSELSSVT ESSVITGENQ NTGIKDELVE SSETFPEIDE  240
SFWSGALSAE NSGIPVDYPA TTTDIGSQFQ YNPVYTTEPI SAYNWNNTDD GMDFWYNLFI  300
KAGEFQELPE L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28461505108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212RDRERKRDRDR
2145151LKKRLRQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274769.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A061ELW61e-113A0A061ELW6_THECC; Myb domain protein 13, putative
STRINGPOPTR_0008s16660.11e-105(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.15e-83myb domain protein 14